PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02394.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 245aa    MW: 28093.2 Da    PI: 10.0939
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02394.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-161461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg WT+eEd  lv +++++G ++W + +++ g++R++k+c++rw++yl
  Rsa1.0_02394.1_g00003.1 14 RGEWTAEEDRMLVAYINKYGVRDWGALPKRAGLHRCGKSCRLRWLNYL 61
                             89********************************************97 PP

2Myb_DNA-binding56.66.1e-1867111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +g++T++E+e +++ + +lG++ W++Ia+ m+ +Rt++++k++w++ 
  Rsa1.0_02394.1_g00003.1  67 KGKFTPQEEEDIIKFHSLLGNR-WAAIAKQMP-NRTDNDIKNHWNSC 111
                              79********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.184961IPR017930Myb domain
SuperFamilySSF466893.52E-3011108IPR009057Homeodomain-like
SMARTSM007179.2E-161363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-231568IPR009057Homeodomain-like
CDDcd001676.08E-111661No hitNo description
PROSITE profilePS5129426.04462116IPR017930Myb domain
SMARTSM007175.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1667111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2569116IPR009057Homeodomain-like
CDDcd001674.73E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRTTWFDVD GIKRGEWTAE EDRMLVAYIN KYGVRDWGAL PKRAGLHRCG KSCRLRWLNY  60
LKPGIKKGKF TPQEEEDIIK FHSLLGNRWA AIAKQMPNRT DNDIKNHWNS CLKKRLRRNG  120
IDPMTHGPIK TTSSTRSSPA RRHSSSTTSF SLSSTGSVRL LNKLAAGISS RKLGLDRIKT  180
VMISSEPRQV DEEEKVMIGS KKEEEKVIGC FMEIDKNLIS TMSLDELPCD SSYYFHDDWF  240
RGCFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619876.11e-161PREDICTED: transcription factor MYB34-like
RefseqXP_013726480.11e-161PREDICTED: transcription factor MYB34-like
RefseqXP_013726482.11e-161PREDICTED: transcription factor MYB34-like
SwissprotO643992e-56MYB34_ARATH; Transcription factor MYB34
TrEMBLA0A078HV831e-161A0A078HV83_BRANA; BnaC02g22880D protein
TrEMBLA0A0D3AQH41e-161A0A0D3AQH4_BRAOL; Uncharacterized protein
STRINGBra008149.1-P1e-159(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74430.11e-106myb domain protein 95